Lineage for d3c09c2 (3c09 C:122-218)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2022294Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 2022298Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2022548Domain d3c09c2: 3c09 C:122-218 [155814]
    Other proteins in same PDB: d3c09a1, d3c09a2, d3c09a3, d3c09c1, d3c09d1, d3c09d2, d3c09d3, d3c09h1
    automatically matched to d1ngwb2
    complexed with bma, man, nag

Details for d3c09c2

PDB Entry: 3c09 (more details), 3.2 Å

PDB Description: crystal structure the fab fragment of matuzumab (fab72000) in complex with domain iii of the extracellular region of egfr
PDB Compounds: (C:) Matuzumab Fab Heavy chain

SCOPe Domain Sequences for d3c09c2:

Sequence, based on SEQRES records: (download)

>d3c09c2 b.1.1.2 (C:122-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkk

Sequence, based on observed residues (ATOM records): (download)

>d3c09c2 b.1.1.2 (C:122-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvyicnvnh
kpsntkvdkk

SCOPe Domain Coordinates for d3c09c2:

Click to download the PDB-style file with coordinates for d3c09c2.
(The format of our PDB-style files is described here.)

Timeline for d3c09c2: