Lineage for d3bzwd_ (3bzw D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465640Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2465752Family c.23.10.9: BT2961-like [159485] (3 proteins)
    PfamB PB005894;homotrimeric assembly
  6. 2465753Protein Uncharacterized protein BT2961 [159486] (1 species)
    putative lipase
  7. 2465754Species Bacteroides thetaiotaomicron [TaxId:818] [159487] (1 PDB entry)
    Uniprot Q8A3J3 38-285
  8. 2465758Domain d3bzwd_: 3bzw D: [155795]
    automated match to d3bzwa1
    complexed with act, so4

Details for d3bzwd_

PDB Entry: 3bzw (more details), 1.87 Å

PDB Description: crystal structure of a putative lipase from bacteroides thetaiotaomicron
PDB Compounds: (D:) Putative lipase

SCOPe Domain Sequences for d3bzwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzwd_ c.23.10.9 (D:) Uncharacterized protein BT2961 {Bacteroides thetaiotaomicron [TaxId: 818]}
iqhpwqgkkvgyigdsitdpncygdnikkywdflkewlgitpfvygisgrqwddvprqae
klkkehggevdailvfmgtndynssvpigewfteqeeqvlsahgemkkmvtrkkrtpvmt
qdtyrgrinigitqlkklfpdkqivlltplhrslanfgdknvqpdesyqngcgeyidayv
qaikeagniwgipvidfnavtgmnpmveeqliyfydagydrlhpdtkgqermartlmyql
lalpvaf

SCOPe Domain Coordinates for d3bzwd_:

Click to download the PDB-style file with coordinates for d3bzwd_.
(The format of our PDB-style files is described here.)

Timeline for d3bzwd_: