SCOP 1.65: Domain d1outb_: 1out B:

Lineage for d1outb_ (1out B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Trout (Oncorhynchus mykiss) [TaxId:8022] [46510] (2 PDB entries)

8. Domain d1outb_: 1out B: [15579]
   Other proteins in same PDB: d1outa_
   complexed with ace, hem; mutant

Details for d1outb_

PDB Entry: 1out, 2.3 Å

PDB Description: trout hemoglobin i

SCOP Domain Sequences for d1outb_:

Sequence; same for both SEQRES and ATOM records:

>d1outb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Trout (Oncorhynchus mykiss)}
vewtdaekstisavwgkvnideigplalarvlivypwtqryfgsfgnvstpaaimgnpkv
aahgkvvcgaldkavknmgnilatykslsethanklfvdpdnfrvladvltiviaakfga
sftpeiqatwqkfmkvvvaamgsryf

Timeline for d1outb_:

• d1outb_ first appeared (with stable ids) in SCOP 1.55
  
• d1outb_ appears in SCOP 1.63
  
• d1outb_ appears in SCOP 1.67
  
• d1outb_ appears in the current release, SCOPe 2.08