Lineage for d3buza2 (3buz A:210-413)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681419Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1681420Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1681421Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1681466Protein Enzymatic component (Ia) of iota-toxin [82812] (1 species)
    mammalian-targeted relative of VIP2; C-terminal domain is catalytic, N-terminal domain interacts with Ib (binding component)
  7. 1681467Species Clostridium perfringens [TaxId:1502] [82813] (3 PDB entries)
  8. 1681475Domain d3buza2: 3buz A:210-413 [155657]
    Other proteins in same PDB: d3buzb1, d3buzb2
    automated match to d1giqa2
    complexed with atp, ca, lar, tad

Details for d3buza2

PDB Entry: 3buz (more details), 2.81 Å

PDB Description: Crystal structure of ia-bTAD-actin complex
PDB Compounds: (A:) Iota toxin component Ia

SCOPe Domain Sequences for d3buza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buza2 d.166.1.1 (A:210-413) Enzymatic component (Ia) of iota-toxin {Clostridium perfringens [TaxId: 1502]}
sldfkddvskgdlwgkenysdwsnkltpneladvndymrggytainnylisngplnnpnp
eldskvnnienalkltpipsnlivyrrsgpqefgltltspeydfnkienidafkekwegk
vitypnfistsigsvnmsafakrkiilrinipkdspgaylsaipgyageyevllnhgskf
kinkvdsykdgtvtklildatlin

SCOPe Domain Coordinates for d3buza2:

Click to download the PDB-style file with coordinates for d3buza2.
(The format of our PDB-style files is described here.)

Timeline for d3buza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3buza1