![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
![]() | Protein Enzymatic component (Ia) of iota-toxin [82812] (1 species) mammalian-targeted relative of VIP2; C-terminal domain is catalytic, N-terminal domain interacts with Ib (binding component) |
![]() | Species Clostridium perfringens [TaxId:1502] [82813] (3 PDB entries) |
![]() | Domain d3buza2: 3buz A:210-413 [155657] Other proteins in same PDB: d3buzb1, d3buzb2 automated match to d1giqa2 complexed with atp, ca, lar, tad |
PDB Entry: 3buz (more details), 2.81 Å
SCOPe Domain Sequences for d3buza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3buza2 d.166.1.1 (A:210-413) Enzymatic component (Ia) of iota-toxin {Clostridium perfringens [TaxId: 1502]} sldfkddvskgdlwgkenysdwsnkltpneladvndymrggytainnylisngplnnpnp eldskvnnienalkltpipsnlivyrrsgpqefgltltspeydfnkienidafkekwegk vitypnfistsigsvnmsafakrkiilrinipkdspgaylsaipgyageyevllnhgskf kinkvdsykdgtvtklildatlin
Timeline for d3buza2: