Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Cbl [55587] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55588] (9 PDB entries) |
Domain d3bumb3: 3bum B:264-351 [155625] Other proteins in same PDB: d3bumb1, d3bumb2 automatically matched to d1fbva3 |
PDB Entry: 3bum (more details), 2 Å
SCOPe Domain Sequences for d3bumb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bumb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]} thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp lfqalidgfregfylfpdgrnqnpdltg
Timeline for d3bumb3: