Lineage for d3bu8a1 (3bu8 A:44-245)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926529Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
    multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain
  4. 926530Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) (S)
  5. 926531Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (2 proteins)
  6. 926536Protein TRF2 [63604] (1 species)
  7. 926537Species Human (Homo sapiens) [TaxId:9606] [63605] (3 PDB entries)
  8. 926540Domain d3bu8a1: 3bu8 A:44-245 [155595]
    automatically matched to d1h6pa_
    protein/DNA complex

Details for d3bu8a1

PDB Entry: 3bu8 (more details), 2.15 Å

PDB Description: Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex
PDB Compounds: (A:) Telomeric repeat-binding factor 2

SCOPe Domain Sequences for d3bu8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bu8a1 a.146.1.1 (A:44-245) TRF2 {Human (Homo sapiens) [TaxId: 9606]}
gearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllrv
mqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaavi
iciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkmlr
fleshlddaepylltmakkalk

SCOPe Domain Coordinates for d3bu8a1:

Click to download the PDB-style file with coordinates for d3bu8a1.
(The format of our PDB-style files is described here.)

Timeline for d3bu8a1: