Lineage for d3btjb1 (3btj B:2-72)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305653Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2305738Protein Multidrug binding protein QacR [68964] (1 species)
  7. 2305739Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
    Uniprot P23217
  8. 2305787Domain d3btjb1: 3btj B:2-72 [155576]
    Other proteins in same PDB: d3btja2, d3btjb2, d3btjd2, d3btje2
    automatically matched to d1jt0a1
    complexed with deq, so4

Details for d3btjb1

PDB Entry: 3btj (more details), 2.98 Å

PDB Description: crystal structure of qacr(e58q) bound to dequalinium
PDB Compounds: (B:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3btjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btjb1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieqskw
qeqwkkeqika

SCOPe Domain Coordinates for d3btjb1:

Click to download the PDB-style file with coordinates for d3btjb1.
(The format of our PDB-style files is described here.)

Timeline for d3btjb1: