Lineage for d3bt2l2 (3bt2 L:107-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752813Domain d3bt2l2: 3bt2 L:107-212 [155546]
    Other proteins in same PDB: d3bt2a1, d3bt2a2, d3bt2b_, d3bt2h_, d3bt2l1, d3bt2u1, d3bt2u2, d3bt2u3
    automated match to d1h3pl2
    complexed with nag

Details for d3bt2l2

PDB Entry: 3bt2 (more details), 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (L:) anti-uPAR antibody, light chain

SCOPe Domain Sequences for d3bt2l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt2l2 b.1.1.2 (L:107-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d3bt2l2:

Click to download the PDB-style file with coordinates for d3bt2l2.
(The format of our PDB-style files is described here.)

Timeline for d3bt2l2: