![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (7 proteins) |
![]() | Protein Urokinase-type plasminogen activator [57453] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57454] (7 PDB entries) |
![]() | Domain d3bt2a2: 3bt2 A:50-132 [155541] Other proteins in same PDB: d3bt2a1, d3bt2b_, d3bt2h_, d3bt2l1, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3 automated match to d1urka2 complexed with nag |
PDB Entry: 3bt2 (more details), 2.5 Å
SCOPe Domain Sequences for d3bt2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bt2a2 g.14.1.1 (A:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]} cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr rpwcyvqvglkplvqecmvhdca
Timeline for d3bt2a2: