Lineage for d3bt2a2 (3bt2 A:50-132)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033384Protein Urokinase-type plasminogen activator [57453] (1 species)
  7. 3033385Species Human (Homo sapiens) [TaxId:9606] [57454] (7 PDB entries)
  8. 3033390Domain d3bt2a2: 3bt2 A:50-132 [155541]
    Other proteins in same PDB: d3bt2a1, d3bt2b_, d3bt2h_, d3bt2l1, d3bt2l2, d3bt2u1, d3bt2u2, d3bt2u3
    automated match to d1urka2
    complexed with nag

Details for d3bt2a2

PDB Entry: 3bt2 (more details), 2.5 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d3bt2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt2a2 g.14.1.1 (A:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

SCOPe Domain Coordinates for d3bt2a2:

Click to download the PDB-style file with coordinates for d3bt2a2.
(The format of our PDB-style files is described here.)

Timeline for d3bt2a2: