| Class g: Small proteins [56992] (100 folds) |
| Fold g.64: Somatomedin B domain [90187] (1 superfamily) disulfide-rich |
Superfamily g.64.1: Somatomedin B domain [90188] (1 family) ![]() automatically mapped to Pfam PF01033 |
| Family g.64.1.1: Somatomedin B domain [90189] (1 protein) |
| Protein Vitronectin [90190] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [90191] (6 PDB entries) Uniprot P04004 20-70 |
| Domain d3bt1b_: 3bt1 B: [155536] Other proteins in same PDB: d3bt1a1, d3bt1a2, d3bt1u1, d3bt1u2, d3bt1u3 automated match to d1s4ga_ complexed with nag |
PDB Entry: 3bt1 (more details), 2.8 Å
SCOPe Domain Sequences for d3bt1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bt1b_ g.64.1.1 (B:) Vitronectin {Human (Homo sapiens) [TaxId: 9606]}
qesckgrctegfnvdkkcqcdelcsyyqscctdytaeckp
Timeline for d3bt1b_: