| Class g: Small proteins [56992] (90 folds) |
| Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) ![]() |
| Family g.14.1.1: Kringle modules [57441] (7 proteins) |
| Protein Urokinase-type plasminogen activator [57453] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57454] (7 PDB entries) |
| Domain d3bt1a2: 3bt1 A:50-132 [155535] Other proteins in same PDB: d3bt1a1, d3bt1b_, d3bt1u1, d3bt1u2, d3bt1u3 automatically matched to d1urka2 complexed with nag |
PDB Entry: 3bt1 (more details), 2.8 Å
SCOPe Domain Sequences for d3bt1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bt1a2 g.14.1.1 (A:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca
Timeline for d3bt1a2:
View in 3DDomains from other chains: (mouse over for more information) d3bt1b_, d3bt1u1, d3bt1u2, d3bt1u3 |