Lineage for d3bt1a1 (3bt1 A:8-49)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459896Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1459897Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1460198Protein Plasminogen activator (urokinase-type) [57221] (1 species)
  7. 1460199Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries)
  8. 1460210Domain d3bt1a1: 3bt1 A:8-49 [155534]
    Other proteins in same PDB: d3bt1a2, d3bt1b_, d3bt1u1, d3bt1u2, d3bt1u3
    automatically matched to d1urka1
    complexed with nag

Details for d3bt1a1

PDB Entry: 3bt1 (more details), 2.8 Å

PDB Description: structure of urokinase receptor, urokinase and vitronectin complex
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d3bt1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt1a1 g.3.11.1 (A:8-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}
psncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt

SCOPe Domain Coordinates for d3bt1a1:

Click to download the PDB-style file with coordinates for d3bt1a1.
(The format of our PDB-style files is described here.)

Timeline for d3bt1a1: