Lineage for d3bofa1 (3bof A:301-560)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 974814Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 974839Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins)
  6. 974840Protein Cobalamin-dependent methionine synthase MetH, C-terminal domain [102104] (1 species)
    5-methyltetrahydrofolate homocysteine S-methyltransferase
  7. 974841Species Thermotoga maritima [TaxId:2336] [102105] (8 PDB entries)
  8. 974842Domain d3bofa1: 3bof A:301-560 [155445]
    Other proteins in same PDB: d3bofa2, d3bofb2
    automatically matched to d1q7qa1
    complexed with hcs, k, yt3, zn

Details for d3bofa1

PDB Entry: 3bof (more details), 1.7 Å

PDB Description: Cobalamin-dependent methionine synthase (1-566) from Thermotoga maritima complexed with Zn2+ and Homocysteine
PDB Compounds: (A:) 5-methyltetrahydrofolate S-homocysteine methyltransferase

SCOPe Domain Sequences for d3bofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
detlmktlnatlvilekkel

SCOPe Domain Coordinates for d3bofa1:

Click to download the PDB-style file with coordinates for d3bofa1.
(The format of our PDB-style files is described here.)

Timeline for d3bofa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bofa2