Lineage for d3bnca2 (3bnc A:1-149)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 941841Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 941842Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 941843Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 941849Protein Plant lipoxigenase [49725] (2 species)
  7. 941850Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (13 PDB entries)
  8. 941856Domain d3bnca2: 3bnc A:1-149 [155433]
    Other proteins in same PDB: d3bnca1
    automatically matched to d1ygea2
    complexed with acy, fe; mutant

Details for d3bnca2

PDB Entry: 3bnc (more details), 1.65 Å

PDB Description: lipoxygenase-1 (soybean) i553g mutant
PDB Compounds: (A:) seed lipoxygenase-1

SCOPe Domain Sequences for d3bnca2:

Sequence, based on SEQRES records: (download)

>d3bnca2 b.12.1.1 (A:1-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
gtirfvcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records): (download)

>d3bnca2 b.12.1.1 (A:1-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
mfsaghkikgtvvlmpknnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslp
tlgagesafnihfewdgsmgipgafyiknymqvefflksltleagtirfvcnswvyntkl
yksvriffanhty

SCOPe Domain Coordinates for d3bnca2:

Click to download the PDB-style file with coordinates for d3bnca2.
(The format of our PDB-style files is described here.)

Timeline for d3bnca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bnca1