![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.14: Sbal0622-like [159985] (1 protein) PfamB PB002762 |
![]() | Protein Uncharacterized protein Sbal0622 [159986] (1 species) |
![]() | Species Shewanella baltica [TaxId:62322] [159987] (1 PDB entry) Uniprot A3D088 3-126 |
![]() | Domain d3blze_: 3blz E: [155407] automated match to d3blza1 complexed with edo, peg |
PDB Entry: 3blz (more details), 1.75 Å
SCOPe Domain Sequences for d3blze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3blze_ d.17.4.14 (E:) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]} nttyvqeyhaivevlskyneggkkadstimrpafssqatifgvdvdnkltggpiqglfdv idnvfhpspeakaaiaridivgtaasaridtddisgfrftdffnllkvegkwtvvskiyh thps
Timeline for d3blze_: