Lineage for d3blrb1 (3blr B:151-259)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918296Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 918297Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 918298Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 918560Protein Cyclin T1 [158595] (1 species)
  7. 918561Species Human (Homo sapiens) [TaxId:9606] [158596] (4 PDB entries)
    Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150
  8. 918564Domain d3blrb1: 3blr B:151-259 [155400]
    Other proteins in same PDB: d3blra_
    automatically matched to 3BLH B:151-259
    complexed with cpb, po4

Details for d3blrb1

PDB Entry: 3blr (more details), 2.8 Å

PDB Description: crystal structure of human cdk9/cyclint1 in complex with flavopiridol
PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d3blrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3blrb1 a.74.1.1 (B:151-259) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr

SCOPe Domain Coordinates for d3blrb1:

Click to download the PDB-style file with coordinates for d3blrb1.
(The format of our PDB-style files is described here.)

Timeline for d3blrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3blrb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3blra_