SCOPe 2.07: Domain d3bkuc_: 3bku C:

Lineage for d3bkuc_ (3bku C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (2 proteins)
   automatically mapped to Pfam PF08753

6. Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)

7. Species Escherichia coli [TaxId:562] [103001] (8 PDB entries)

8. Domain d3bkuc_: 3bku C: [155370]
   automated match to d1q5ya_

Details for d3bkuc_

PDB Entry: 3bku, 2.1 Å

PDB Description: apo c-terminal domain of nikr

PDB Compounds: (C:) Nickel-responsive regulator

SCOPe Domain Sequences for d3bkuc_:

Sequence; same for both SEQRES and ATOM records:

>d3bkuc_ d.58.18.4 (C:) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
qgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvqh
faddviaqrgvrhghlqclpked

Timeline for d3bkuc_:

• d3bkuc_ first appeared in SCOP 1.75, called d3bkuc1
  
• d3bkuc_ appears in SCOPe 2.06
  
• d3bkuc_ appears in the current release, SCOPe 2.08