Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (14 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein) |
Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species) |
Species Escherichia coli [TaxId:562] [103001] (7 PDB entries) |
Domain d3bkta1: 3bkt A:50-131 [155364] automatically matched to d1q5vb2 complexed with cu |
PDB Entry: 3bkt (more details), 1.5 Å
SCOPe Domain Sequences for d3bkta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bkta1 d.58.18.4 (A:50-131) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]} tqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvq hfaddviaqrgvrhghlqclpk
Timeline for d3bkta1: