Lineage for d3bkta1 (3bkt A:50-131)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206627Superfamily d.58.18: ACT-like [55021] (14 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 1206667Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein)
  6. 1206668Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 1206669Species Escherichia coli [TaxId:562] [103001] (7 PDB entries)
  8. 1206674Domain d3bkta1: 3bkt A:50-131 [155364]
    automatically matched to d1q5vb2
    complexed with cu

Details for d3bkta1

PDB Entry: 3bkt (more details), 1.5 Å

PDB Description: copper-bound c-terminal domain of nikr
PDB Compounds: (A:) Nickel-responsive regulator

SCOPe Domain Sequences for d3bkta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bkta1 d.58.18.4 (A:50-131) Nickel responsive regulator NikR, C-terminal domain {Escherichia coli [TaxId: 562]}
tqgfavlsyvyehekrdlasrivstqhhhhdlsvatlhvhinhddcleiavlkgdmgdvq
hfaddviaqrgvrhghlqclpk

SCOPe Domain Coordinates for d3bkta1:

Click to download the PDB-style file with coordinates for d3bkta1.
(The format of our PDB-style files is described here.)

Timeline for d3bkta1: