Lineage for d3bjma1 (3bjm A:39-508)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960620Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 960709Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
  5. 960710Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
    Pfam PF00930
  6. 960717Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 960718Species Human (Homo sapiens) [TaxId:9606] [82174] (29 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 960749Domain d3bjma1: 3bjm A:39-508 [155332]
    Other proteins in same PDB: d3bjma2, d3bjmb2
    automatically matched to d1orva1
    complexed with bjm, nag

Details for d3bjma1

PDB Entry: 3bjm (more details), 2.35 Å

PDB Description: crystal structure of human dpp-iv in complex with (1s,3s, 5s)-2-[(2s)- 2-amino-2-(3-hydroxytricyclo[3.3.1.13,7]dec-1- yl)acetyl]-2- azabicyclo[3.1.0]hexane-3-carbonitrile (cas), (1s,3s,5s)-2-((2s)-2- amino-2-(3-hydroxyadamantan-1- yl)acetyl)-2-azabicyclo[3.1.0]hexane- 3-carbonitrile (iupac), or bms-477118
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3bjma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjma1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d3bjma1:

Click to download the PDB-style file with coordinates for d3bjma1.
(The format of our PDB-style files is described here.)

Timeline for d3bjma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bjma2