Lineage for d3bimd_ (3bim D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903246Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1903247Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 1903248Species Human (Homo sapiens) [TaxId:9606] [102923] (7 PDB entries)
  8. 1903273Domain d3bimd_: 3bim D: [155314]
    automated match to d1r2ba_
    protein/DNA complex

Details for d3bimd_

PDB Entry: 3bim (more details), 2.6 Å

PDB Description: crystal structure of the bcl6 btb domain dimer in complex with the bcor bbd corepressor peptide
PDB Compounds: (D:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d3bimd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bimd_ d.42.1.1 (D:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
ikas

SCOPe Domain Coordinates for d3bimd_:

Click to download the PDB-style file with coordinates for d3bimd_.
(The format of our PDB-style files is described here.)

Timeline for d3bimd_: