SCOPe 2.05: Domain d3bimb_: 3bim B:

Lineage for d3bimb_ (3bim B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102923] (7 PDB entries)

8. Domain d3bimb_: 3bim B: [155312]
   automated match to d1r2ba_
   protein/DNA complex

Details for d3bimb_

PDB Entry: 3bim, 2.6 Å

PDB Description: crystal structure of the bcl6 btb domain dimer in complex with the bcor bbd corepressor peptide

PDB Compounds: (B:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d3bimb_:

Sequence; same for both SEQRES and ATOM records:

>d3bimb_ d.42.1.1 (B:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
ikas

Timeline for d3bimb_:

• d3bimb_ first appeared in SCOP 1.75, called d3bimb1
  
• d3bimb_ appears in SCOPe 2.04
  
• d3bimb_ appears in SCOPe 2.06
  
• d3bimb_ appears in the current release, SCOPe 2.08