SCOPe 2.01: Domain d3bidf_: 3bid F:

Lineage for d3bidf_ (3bid F:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.348: YegP-like [160112] (1 superfamily)
   comprises two subunits or tandem repeats of beta(3)-alpha-beta motifs; these assemble with the formation of a single beta-sheet and swapping of the C-terminal strands

4. Superfamily d.348.1: YegP-like [160113] (1 family)

5. Family d.348.1.1: YegP-like [160114] (4 proteins)
   Pfam PF07411; DUF1508

6. Protein Uncharacterized protein NMB1088 [160121] (1 species)
   homodimer

7. Species Neisseria meningitidis [TaxId:487] [160122] (1 PDB entry)
   Uniprot Q7DDI1 1-56

8. Domain d3bidf_: 3bid F: [155304]
   automated match to d3bida1

Details for d3bidf_

PDB Entry: 3bid, 2.7 Å

PDB Description: crystal structure of the nmb1088 protein from neisseria meningitidis. northeast structural genomics consortium target mr91

PDB Compounds: (F:) UPF0339 protein NMB1088

SCOPe Domain Sequences for d3bidf_:

Sequence; same for both SEQRES and ATOM records:

>d3bidf_ d.348.1.1 (F:) Uncharacterized protein NMB1088 {Neisseria meningitidis [TaxId: 487]}
myfeiykdakgeyrwrlkaanheiiaqgegytskqncqhavdllksttaatpvkevle

Timeline for d3bidf_:

• d3bidf_ first appeared in SCOP 1.75, called d3bidf1
  
• d3bidf_ appears in SCOPe 2.02
  
• d3bidf_ appears in the current release, SCOPe 2.08, called d3bidf2