Lineage for d3bf3e1 (3bf3 E:-2-118)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858385Family c.55.1.13: CoaX-like [142484] (1 protein)
    Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf
  6. 1858386Protein Type III pantothenate kinase, CoaX [142485] (3 species)
  7. 1858401Species Thermotoga maritima [TaxId:2336] [142486] (4 PDB entries)
    Uniprot Q9WZY5 1-118! Uniprot Q9WZY5 119-245
  8. 1858422Domain d3bf3e1: 3bf3 E:-2-118 [155230]
    automated match to d3bf3b1
    complexed with mg, paz

Details for d3bf3e1

PDB Entry: 3bf3 (more details), 1.63 Å

PDB Description: Type III pantothenate kinase from Thermotoga maritima complexed with product phosphopantothenate
PDB Compounds: (E:) Type III pantothenate kinase

SCOPe Domain Sequences for d3bf3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bf3e1 c.55.1.13 (E:-2-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]}
mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
g

SCOPe Domain Coordinates for d3bf3e1:

Click to download the PDB-style file with coordinates for d3bf3e1.
(The format of our PDB-style files is described here.)

Timeline for d3bf3e1: