| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.13: CoaX-like [142484] (1 protein) Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf |
| Protein Type III pantothenate kinase, CoaX [142485] (3 species) |
| Species Thermotoga maritima [TaxId:2336] [142486] (4 PDB entries) Uniprot Q9WZY5 1-118! Uniprot Q9WZY5 119-245 |
| Domain d3bf3b2: 3bf3 B:119-245 [155225] automated match to d3bf3b2 complexed with mg, paz |
PDB Entry: 3bf3 (more details), 1.63 Å
SCOPe Domain Sequences for d3bf3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bf3b2 c.55.1.13 (B:119-245) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]}
kngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgkd
teenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltikg
vyhfcfg
Timeline for d3bf3b2: