Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) duplication contains two domains of this fold |
Family c.55.1.13: CoaX-like [142484] (1 protein) Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf |
Protein Type III pantothenate kinase, CoaX [142485] (3 species) |
Species Thermotoga maritima [TaxId:2336] [142486] (4 PDB entries) Uniprot Q9WZY5 1-118! Uniprot Q9WZY5 119-245 |
Domain d3bexf2: 3bex F:119-245 [155209] automatically matched to d2gtda2 complexed with pau, po4 |
PDB Entry: 3bex (more details), 1.51 Å
SCOPe Domain Sequences for d3bexf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bexf2 c.55.1.13 (F:119-245) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]} kngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgkd teenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltikg vyhfcfg
Timeline for d3bexf2: