SCOPe 2.02: Domain d3bedb_: 3bed B:

Lineage for d3bedb_ (3bed B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.0: automated matches [191356] (1 protein)
   not a true family

6. Protein automated matches [190395] (3 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [187262] (1 PDB entry)

8. Domain d3bedb_: 3bed B: [155184]
   Other proteins in same PDB: d3beda1
   automated match to d1pdoa_

Details for d3bedb_

PDB Entry: 3bed, 1.45 Å

PDB Description: Mannose/sorbose specific IIA subunit of phosphotransferase system from Enterococcus faecalis

PDB Compounds: (B:) PTS system, IIA component

SCOPe Domain Sequences for d3bedb_:

Sequence; same for both SEQRES and ATOM records:

>d3bedb_ c.54.1.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mkpklilmshgrmaeetlastqmivgeladaaivsmtaedglsgtqaklaailkeagnvp
tlvladlkggtpcnvammamgtypqlrvvaglnlamaieaavspvenvdelaayltqigq
savttidlp

Timeline for d3bedb_:

• d3bedb_ first appeared in SCOP 1.75, called d3bedb1
  
• d3bedb_ appears in SCOPe 2.01
  
• d3bedb_ appears in SCOPe 2.03
  
• d3bedb_ appears in the current release, SCOPe 2.08