Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (8 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries) |
Domain d3bdmp_: 3bdm P: [155144] Other proteins in same PDB: d3bdm01, d3bdm1_, d3bdma_, d3bdme_, d3bdmf1, d3bdmi_, d3bdmj_, d3bdmk_, d3bdmm1, d3bdmn_, d3bdmo_, d3bdms_, d3bdmt1, d3bdmw_, d3bdmx_, d3bdmy_ automated match to d1g65b_ complexed with gdt |
PDB Entry: 3bdm (more details), 2.7 Å
SCOPe Domain Sequences for d3bdmp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bdmp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d3bdmp_:
View in 3D Domains from other chains: (mouse over for more information) d3bdm01, d3bdm1_, d3bdma_, d3bdmb_, d3bdmc_, d3bdmd_, d3bdme_, d3bdmf1, d3bdmg_, d3bdmh_, d3bdmi_, d3bdmj_, d3bdmk_, d3bdml_, d3bdmm1, d3bdmn_, d3bdmo_, d3bdmq_, d3bdmr_, d3bdms_, d3bdmt1, d3bdmu_, d3bdmv_, d3bdmw_, d3bdmx_, d3bdmy_, d3bdmz_ |