SCOPe 2.05: Domain d3bbnk1: 3bbn K:23-122

Lineage for d3bbnk1 (3bbn K:23-122)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein Eukaryotic, chloroplast (70S ribosome functional complex) [267637] (1 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [267691] (2 PDB entries)

8. Domain d3bbnk1: 3bbn K:23-122 [155076]

Details for d3bbnk1

PDB Entry: 3bbn, 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.

PDB Compounds: (K:) ribosomal protein s11

SCOPe Domain Sequences for d3bbnk1:

Sequence; same for both SEQRES and ATOM records:

>d3bbnk1 i.1.1.1 (K:23-122) Eukaryotic, chloroplast (70S ribosome functional complex) {Spinach (Spinacia oleracea) [TaxId: 3562]}
rkipkgvihvqasfnntivtvtdvrgrvvswasagtcgfrgtkrgtpfaaqtaagnairt
vveqgmqraevmikgpglgrdaalrairrsgillsfvrdv

Timeline for d3bbnk1:

• d3bbnk1 first appeared in SCOP 1.75
  
• d3bbnk1 appears in SCOPe 2.04
  
• d3bbnk1 appears in SCOPe 2.06
  
• d3bbnk1 appears in the current release, SCOPe 2.08