Lineage for d3bbnl1 (3bbn L:28-123)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1971461Protein Eukaryotic, chloroplast (70S ribosome functional complex) [267637] (1 species)
  7. 1971462Species Spinach (Spinacia oleracea) [TaxId:3562] [267691] (2 PDB entries)
  8. 1971467Domain d3bbnl1: 3bbn L:28-123 [155077]

Details for d3bbnl1

PDB Entry: 3bbn (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.
PDB Compounds: (L:) ribosomal protein s12

SCOPe Domain Sequences for d3bbnl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbnl1 i.1.1.1 (L:28-123) Eukaryotic, chloroplast (70S ribosome functional complex) {Spinach (Spinacia oleracea) [TaxId: 3562]}
pqrrgtctrvytitpkkpnsalrkvarvrltsgfeitayipgighnlqehsvvlvrggrv
kdlpgvryhivrgtldavgvkdrqqgrskygvkkpk

SCOPe Domain Coordinates for d3bbnl1:

Click to download the PDB-style file with coordinates for d3bbnl1.
(The format of our PDB-style files is described here.)

Timeline for d3bbnl1: