Class b: All beta proteins [48724] (178 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins) |
Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63740] (57 PDB entries) Uniprot P09960 |
Domain d3b7ta2: 3b7t A:1-208 [154944] Other proteins in same PDB: d3b7ta1, d3b7ta3 automated match to d3b7sa2 complexed with imd, yb, zn |
PDB Entry: 3b7t (more details), 2.3 Å
SCOPe Domain Sequences for d3b7ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7ta2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd pedpsrkiykfiqkvpipcylialvvga
Timeline for d3b7ta2: