Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.13: Leukotriene A4 hydrolase catalytic domain [64338] (1 protein) adopts thermolysin-like fold |
Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64340] (15 PDB entries) Uniprot P09960 |
Domain d3b7sa3: 3b7s A:209-460 [154942] Other proteins in same PDB: d3b7sa1, d3b7sa2 automatically matched to d1gw6a3 complexed with acy, gol, yb, zn |
PDB Entry: 3b7s (more details), 1.47 Å
SCOPe Domain Sequences for d3b7sa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7sa3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg gmenpcltfvtptllagdkslsnviahqishswtgnlvtnktwdhfwlneghtvylerhi cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl yspglppikpny
Timeline for d3b7sa3: