SCOPe 2.08: Domain d3b6pc_: 3b6p C:

Lineage for d3b6pc_ (3b6p C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries)

8. Domain d3b6pc_: 3b6p C: [154907]
   automated match to d1y97a1
   protein/DNA complex; complexed with na, tmp, zn

Details for d3b6pc_

PDB Entry: 3b6p, 2.3 Å

PDB Description: Structure of TREX1 in complex with a nucleotide and inhibitor ions (sodium and zinc)

PDB Compounds: (C:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d3b6pc_:

Sequence, based on SEQRES records:

>d3b6pc_ c.55.3.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrlyw
qaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records):

>d3b6pc_ c.55.3.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta
egdvltllsicqwkpqallqwvdeharpfstvkpmyg

Timeline for d3b6pc_:

• d3b6pc_ first appeared in SCOP 1.75, called d3b6pc1
  
• d3b6pc_ appears in SCOPe 2.07