| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2A [47115] (7 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (24 PDB entries) |
| Domain d3b6gg1: 3b6g G:15-118 [154898] Other proteins in same PDB: d3b6ga1, d3b6gb1, d3b6gd1, d3b6ge1, d3b6gf1, d3b6gh1 automatically matched to d1aoic_ protein/DNA complex; complexed with mn |
PDB Entry: 3b6g (more details), 3.45 Å
SCOPe Domain Sequences for d3b6gg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b6gg1 a.22.1.1 (G:15-118) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
Timeline for d3b6gg1: