![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (7 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries) |
![]() | Domain d3b6gb1: 3b6g B:24-102 [154893] Other proteins in same PDB: d3b6ga1, d3b6gc1, d3b6gd1, d3b6ge1, d3b6gg1, d3b6gh1 automatically matched to d1p3ob_ protein/DNA complex; complexed with mn |
PDB Entry: 3b6g (more details), 3.45 Å
SCOPe Domain Sequences for d3b6gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b6gb1 a.22.1.1 (B:24-102) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta mdvvyalkrqgrtlygfgg
Timeline for d3b6gb1: