Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Cervical EMMPRIN [158877] (1 species) contains two Ig-domains in the N-terminal part |
Species Human (Homo sapiens) [TaxId:9606] [158878] (1 PDB entry) Uniprot Q54A51 103-203! Uniprot Q54A51 23-102 |
Domain d3b5ha1: 3b5h A:103-203 [154838] complexed with act |
PDB Entry: 3b5h (more details), 2.8 Å
SCOPe Domain Sequences for d3b5ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} gpprvkavkssehinegetamlvcksesvppvtdwawykitdsedkalmngsesrffvss sqgrselhienlnmeadpgqyrcngtsskgsdqaiitlrvr
Timeline for d3b5ha1: