Lineage for d3b3ra1 (3b3r A:5-318,A:451-506)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2457696Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2457697Protein Cholesterol oxidase of GMC family [51914] (3 species)
  7. 2457703Species Streptomyces sp. [TaxId:1931] [51916] (14 PDB entries)
  8. 2457709Domain d3b3ra1: 3b3r A:5-318,A:451-506 [154815]
    Other proteins in same PDB: d3b3ra2, d3b3ra3
    automatically matched to d1ijha1
    complexed with fae, gol, so4; mutant

Details for d3b3ra1

PDB Entry: 3b3r (more details), 0.98 Å

PDB Description: crystal structure of streptomyces cholesterol oxidase h447q/e361q mutant bound to glycerol (0.98a)
PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d3b3ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b3ra1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}
adnggyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkr
sswfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmav
epkrsyfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagka
glgtvfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvti
qtlhqvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardt
gtlpnlnsevgagwXgcvlgkatddygrvagyknlyvtdgslipgsvgvnpfvtitalae
rnveriikqdv

SCOPe Domain Coordinates for d3b3ra1:

Click to download the PDB-style file with coordinates for d3b3ra1.
(The format of our PDB-style files is described here.)

Timeline for d3b3ra1: