Lineage for d2zpib_ (2zpi B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946680Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 946717Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
  6. 946727Protein Iron-containing nitrile hydratase [50102] (1 species)
  7. 946728Species Rhodococcus erythropolis [TaxId:1833] [50103] (21 PDB entries)
    also Rhodococcus sp. R312
  8. 946736Domain d2zpib_: 2zpi B: [154757]
    Other proteins in same PDB: d2zpia_
    automated match to d1ahjb_
    complexed with fe, mg, tb0, trs

Details for d2zpib_

PDB Entry: 2zpi (more details), 1.49 Å

PDB Description: Complex of Fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 440min at 293K
PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOPe Domain Sequences for d2zpib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpib_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepa

SCOPe Domain Coordinates for d2zpib_:

Click to download the PDB-style file with coordinates for d2zpib_.
(The format of our PDB-style files is described here.)

Timeline for d2zpib_: