SCOPe 2.02: Domain d2zoza2: 2zoz A:74-174

Lineage for d2zoza2 (2zoz A:74-174)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)

6. Protein Transcriptional regulator Cgl2612 [140895] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [140896] (2 PDB entries)
   Uniprot Q8NMG3 75-175

8. Domain d2zoza2: 2zoz A:74-174 [154741]
   Other proteins in same PDB: d2zoza1, d2zozb1
   complexed with et, gol, so4

Details for d2zoza2

PDB Entry: 2zoz, 1.95 Å

PDB Description: Crystal structure of the ethidium-bound form of the multi-drug binding transcriptional repressor CgmR

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2zoza2:

Sequence; same for both SEQRES and ATOM records:

>d2zoza2 a.121.1.1 (A:74-174) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
pedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahk
ravylvqlaadglfvhdyihddvlskskrqamletilelip

Timeline for d2zoza2:

• d2zoza2 first appeared in SCOP 1.75
  
• d2zoza2 appears in SCOPe 2.01
  
• d2zoza2 appears in SCOPe 2.03
  
• d2zoza2 appears in the current release, SCOPe 2.08