Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries) Uniprot P01901 22-299 |
Domain d2zokg1: 2zok G:182-274 [154731] Other proteins in same PDB: d2zoka2, d2zokb_, d2zokc2, d2zokd_, d2zoke2, d2zokf_, d2zokg2, d2zokh_ automatically matched to d1ddha1 complexed with gol, so4 |
PDB Entry: 2zok (more details), 2.1 Å
SCOPe Domain Sequences for d2zokg1:
Sequence, based on SEQRES records: (download)
>d2zokg1 b.1.1.2 (G:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrw
>d2zokg1 b.1.1.2 (G:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhpkgevtlrcwalgfypaditltwqdmelvetrpagdgtfqkwasvvvpl gkeqnytcrvyheglpepltlrw
Timeline for d2zokg1: