Lineage for d2zokg1 (2zok G:182-274)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784408Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 784629Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 784664Domain d2zokg1: 2zok G:182-274 [154731]
    Other proteins in same PDB: d2zoka2, d2zokb1, d2zokc2, d2zokd1, d2zoke2, d2zokf1, d2zokg2, d2zokh1
    automatically matched to d1ddha1
    complexed with aba, gol, so4

Details for d2zokg1

PDB Entry: 2zok (more details), 2.1 Å

PDB Description: crystal structure of h-2db in complex with jhmv epitope s510
PDB Compounds: (G:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d2zokg1:

Sequence, based on SEQRES records: (download)

>d2zokg1 b.1.1.2 (G:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Sequence, based on observed residues (ATOM records): (download)

>d2zokg1 b.1.1.2 (G:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhpkgevtlrcwalgfypaditltwqdmelvetrpagdgtfqkwasvvvpl
gkeqnytcrvyheglpepltlrw

SCOP Domain Coordinates for d2zokg1:

Click to download the PDB-style file with coordinates for d2zokg1.
(The format of our PDB-style files is described here.)

Timeline for d2zokg1: