Lineage for d2zkrh1 (2zkr h:3-167)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2269098Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)
  7. 2269222Species Dog (Canis familiaris) [TaxId:9615] [267690] (2 PDB entries)
  8. 2269239Domain d2zkrh1: 2zkr h:3-167 [154608]
    protein/RNA complex
    protein/RNA complex

Details for d2zkrh1

PDB Entry: 2zkr (more details), 8.7 Å

PDB Description: Structure of a mammalian Ribosomal 60S subunit within an 80S complex obtained by docking homology models of the RNA and proteins into an 8.7 A cryo-EM map
PDB Compounds: (h:) 60S ribosomal protein L10

SCOPe Domain Sequences for d2zkrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkrh1 i.1.1.1 (h:3-167) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Dog (Canis familiaris) [TaxId: 9615]}
rparcyrycknkpypksrfcrgvpdakirifdlgrkkakvdefplcghmvsdeyeqlsse
aleaaricankymvkscgkdgfhirvrlhpfhvirinkmlscagadrlqtgmrgafgkpq
gtvakvhigqvimsirtklqnkehviealrrakfkfpgrqkihis

SCOPe Domain Coordinates for d2zkrh1:

Click to download the PDB-style file with coordinates for d2zkrh1.
(The format of our PDB-style files is described here.)

Timeline for d2zkrh1: