Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins) interrupted by a large insertion, domain N |
Protein Calcium ATPase, catalytic domain P [81655] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (42 PDB entries) Uniprot P04191 |
Domain d2zbea2: 2zbe A:344-360,A:600-750 [154306] Other proteins in same PDB: d2zbea1, d2zbea3, d2zbea4, d2zbeb1, d2zbeb3, d2zbeb4 automatically matched to d1iwoa2 complexed with bef, mg |
PDB Entry: 2zbe (more details), 3.8 Å
SCOPe Domain Sequences for d2zbea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zbea2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg
Timeline for d2zbea2:
View in 3D Domains from other chains: (mouse over for more information) d2zbeb1, d2zbeb2, d2zbeb3, d2zbeb4 |