SCOPe 2.08: Domain d2zbeb3: 2zbe B:361-599

Lineage for d2zbeb3 (2zbe B:361-599)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
   unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432

4. Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family)

5. Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)

6. Protein Calcium ATPase [81658] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (42 PDB entries)
   Uniprot P04191

8. Domain d2zbeb3: 2zbe B:361-599 [154311]
   Other proteins in same PDB: d2zbea1, d2zbea2, d2zbea4, d2zbeb1, d2zbeb2, d2zbeb4
   automatically matched to d1iwoa3
   complexed with bef, mg
   has additional insertions and/or extensions that are not grouped together

Details for d2zbeb3

PDB Entry: 2zbe, 3.8 Å

PDB Description: Calcium pump crystal structure with bound BeF3 in the absence of calcium and TG

PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d2zbeb3:

Sequence; same for both SEQRES and ATOM records:

>d2zbeb3 d.220.1.1 (B:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

Timeline for d2zbeb3:

• d2zbeb3 first appeared in SCOP 1.75
  
• d2zbeb3 appears in SCOPe 2.07