SCOPe 2.01: Domain d2zaub2: 2zau B:155-336

Lineage for d2zaub2 (2zau B:155-336)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)

6. Protein Selenide, water dikinase SelD [160785] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [160786] (3 PDB entries)
   Uniprot O67139 155-336

8. Domain d2zaub2: 2zau B:155-336 [154289]
   Other proteins in same PDB: d2zaua1, d2zaub1, d2zauc1
   automatically matched to 2ZAU A:155-336
   complexed with po4

Details for d2zaub2

PDB Entry: 2zau, 2 Å

PDB Description: Crystal structure of an N-terminally truncated selenophosphate synthetase from Aquifex aeolicus

PDB Compounds: (B:) Selenide, water dikinase

SCOPe Domain Sequences for d2zaub2:

Sequence; same for both SEQRES and ATOM records:

>d2zaub2 d.139.1.1 (B:155-336) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]}
itqsgaqvgqlliltkpigtgilikglkegilkeedineaienmlalndkarnlmlslda
tactdvtgfgllghawnicknsnigariffekvpyyqlsenlvkkkiypkgaienlnfvk
nylksnldnwklillsdpvtsggllftinkeklekidetakelevnywiigetiaenvle
vl

Timeline for d2zaub2:

• d2zaub2 first appeared in SCOP 1.75
  
• d2zaub2 appears in SCOPe 2.02
  
• d2zaub2 appears in the current release, SCOPe 2.08