Lineage for d2z9ka_ (2z9k A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406861Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2406922Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
    contains an extra alpha-helical domain
  7. 2406955Species SARS coronavirus [TaxId:227859] [89349] (82 PDB entries)
  8. 2406976Domain d2z9ka_: 2z9k A: [154256]
    automated match to d1uj1b_
    protein/RNA complex; complexed with dms, doz

Details for d2z9ka_

PDB Entry: 2z9k (more details), 1.85 Å

PDB Description: Complex structure of SARS-CoV 3C-like protease with JMF1600
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d2z9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z9ka_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtf

SCOPe Domain Coordinates for d2z9ka_:

Click to download the PDB-style file with coordinates for d2z9ka_.
(The format of our PDB-style files is described here.)

Timeline for d2z9ka_: