![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d2z91d1: 2z91 D:1-107 [154223] Other proteins in same PDB: d2z91a1, d2z91b2, d2z91c1, d2z91d2 automated match to d1h3pl1 |
PDB Entry: 2z91 (more details), 2.6 Å
SCOPe Domain Sequences for d2z91d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z91d1 b.1.1.0 (D:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} elvmtqtpaimsaspgekvtmtcsasssvssvhwyqqksgtspkrwiydtsklpsgvpgr fsgsgsgtsysltissmeaedaatyycqqwssnpptfgagtklevk
Timeline for d2z91d1:
![]() Domains from other chains: (mouse over for more information) d2z91a1, d2z91b1, d2z91b2, d2z91c1 |