SCOPe 2.08: Domain d2z6wb_: 2z6w B:

Lineage for d2z6wb_ (2z6w B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141512] (46 PDB entries)
   Uniprot P30405 44-207

8. Domain d2z6wb_: 2z6w B: [154185]
   automated match to d2bitx1
   complexed with cit

Details for d2z6wb_

PDB Entry: 2z6w, 0.96 Å

PDB Description: Crystal structure of human cyclophilin D in complex with cyclosporin A

PDB Compounds: (B:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2z6wb_:

Sequence; same for both SEQRES and ATOM records:

>d2z6wb_ b.62.1.1 (B:) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

Timeline for d2z6wb_:

• d2z6wb_ first appeared in SCOP 1.75, called d2z6wb1
  
• d2z6wb_ appears in SCOPe 2.07