Lineage for d2z6ka1 (2z6k A:44-171)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124702Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1124778Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 1124779Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries)
  8. 1124788Domain d2z6ka1: 2z6k A:44-171 [154176]
    Other proteins in same PDB: d2z6kc1, d2z6kd1
    automatically matched to d1l1ob_

Details for d2z6ka1

PDB Entry: 2z6k (more details), 3 Å

PDB Description: Crystal structure of full-length human RPA14/32 heterodimer
PDB Compounds: (A:) Replication protein A 32 kDa subunit

SCOPe Domain Sequences for d2z6ka1:

Sequence, based on SEQRES records: (download)

>d2z6ka1 b.40.4.3 (A:44-171) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevi
nahmvlsk

Sequence, based on observed residues (ATOM records): (download)

>d2z6ka1 b.40.4.3 (A:44-171) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmvls
k

SCOPe Domain Coordinates for d2z6ka1:

Click to download the PDB-style file with coordinates for d2z6ka1.
(The format of our PDB-style files is described here.)

Timeline for d2z6ka1: