Lineage for d2z68a_ (2z68 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505047Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1505048Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1505049Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 1505053Protein Heme oxygenase HmuO [89159] (1 species)
  7. 1505054Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
    Uniprot P71119
  8. 1505066Domain d2z68a_: 2z68 A: [154174]
    automated match to d1iw1a_
    complexed with na, so4, til

Details for d2z68a_

PDB Entry: 2z68 (more details), 1.58 Å

PDB Description: Crystal Structure Of An Artificial Metalloprotein: Cr[N-salicylidene-4-amino-3-hydroxyhydrocinnamic acid]/Wild Type Heme oxygenase
PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d2z68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z68a_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgkgl

SCOPe Domain Coordinates for d2z68a_:

Click to download the PDB-style file with coordinates for d2z68a_.
(The format of our PDB-style files is described here.)

Timeline for d2z68a_: