SCOPe 2.08: Domain d2z4l61: 2z4l 6:1-185

Lineage for d2z4l61 (2z4l 6:1-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families)
   automatically mapped to Pfam PF01765

5. Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)

6. Protein Ribosome recycling factor, RRF [55196] (7 species)

7. Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries)

8. Domain d2z4l61: 2z4l 6:1-185 [154076]
   Other proteins in same PDB: d2z4l01, d2z4l11, d2z4l31, d2z4l41, d2z4lc1, d2z4lc2, d2z4ld1, d2z4le1, d2z4lf1, d2z4lg1, d2z4lg2, d2z4lh1, d2z4lh2, d2z4li1, d2z4li2, d2z4lj1, d2z4lk1, d2z4ll1, d2z4lm1, d2z4ln1, d2z4lo1, d2z4lp1, d2z4lq1, d2z4lr1, d2z4ls1, d2z4lt1, d2z4lu1, d2z4lv1, d2z4lw1, d2z4lx1, d2z4ly1, d2z4lz1
   protein/RNA complex; complexed with mg, par, zn
   protein/RNA complex; complexed with mg, par, zn

Details for d2z4l61

PDB Entry: 2z4l, 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 50S subunit of the first 70S ribosome, with paromomycin and RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (6:) 50S ribosomal protein RRF

SCOPe Domain Sequences for d2z4l61:

Sequence; same for both SEQRES and ATOM records:

>d2z4l61 d.67.3.1 (6:1-185) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]}
mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta
pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq
yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke
qeilg

Timeline for d2z4l61:

• d2z4l61 first appeared in SCOP 1.75
  
• d2z4l61 appears in SCOPe 2.07